Unique product illustration. Packaging, appearance and supplied format vary by project and batch.
Ularitideacetate
Ularitideacetate is listed for source-grounded identity reference and can be reviewed for OEM, ODM, CRO or CDMO scope. Current specification and availability require confirmation.
| CAS number | 118812-69-4 |
| Sequence | TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY(C-C) |
| Molecular formula | C145H234N52O44S3 |
| Molecular weight | 3505.99 |
Current purity, form, stock, pack size, analytical methods, COA/SDS and lead time are confirmed for the quoted project or batch. Public source data does not replace a signed specification.
Request review →Ularitideacetate CDMO and custom manufacturing scope
Ularitideacetate can be evaluated for OEM, ODM, CRO or CDMO work based on identity, intended application, target specification, scale and destination market. The technical team reviews synthesis or sourcing route, analytical requirements, packaging, documentation and commercial feasibility before confirming a program.
What to include in the RFQ
- Product name, CAS number or sequence and any modification or salt form.
- Required grade, target purity or other acceptance criteria and analytical method expectations.
- Sample, pilot or commercial quantity, packaging format and forecast demand.
- Intended research, industrial or cosmetic-development application and destination country.
- Required COA, SDS, chromatogram, method, traceability or export documentation.
Quality and release
Quality evidence belongs to the relevant project and batch. Available analytical methods and release documents are agreed before production. Hytanbio reports ISO 9001, ISO 22000, HACCP and GMP certifications; applicable certificate scope and current originals can be reviewed during qualification.
