info@hytanpeptides.com
Hytan Peptides — Peptide CDMORequest Project Quote
Illustrative packaging concept for FOXO4-DRI

Unique product illustration. Packaging, appearance and supplied format vary by project and batch.

Bulk Peptide Powder

FOXO4-DRI

FOXO4-DRI is listed for source-grounded identity reference and can be reviewed for OEM, ODM, CRO or CDMO scope. Current specification and availability require confirmation.

CAS number2460055-10-9
Sequenceltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg(all D-AA, D型Ile用D-ALLO-Ile)
Molecular formulaC228H388N86O64
Molecular weight5358.06

Current purity, form, stock, pack size, analytical methods, COA/SDS and lead time are confirmed for the quoted project or batch. Public source data does not replace a signed specification.

Request review →

FOXO4-DRI CDMO and custom manufacturing scope

FOXO4-DRI can be evaluated for OEM, ODM, CRO or CDMO work based on identity, intended application, target specification, scale and destination market. The technical team reviews synthesis or sourcing route, analytical requirements, packaging, documentation and commercial feasibility before confirming a program.

What to include in the RFQ

  • Product name, CAS number or sequence and any modification or salt form.
  • Required grade, target purity or other acceptance criteria and analytical method expectations.
  • Sample, pilot or commercial quantity, packaging format and forecast demand.
  • Intended research, industrial or cosmetic-development application and destination country.
  • Required COA, SDS, chromatogram, method, traceability or export documentation.

Quality and release

Quality evidence belongs to the relevant project and batch. Available analytical methods and release documents are agreed before production. Hytanbio reports ISO 9001, ISO 22000, HACCP and GMP certifications; applicable certificate scope and current originals can be reviewed during qualification.

Request this product

Protected by request verification, input validation, a hidden spam field, minimum completion time and IP rate limiting.